General Information

  • ID:  hor004569
  • Uniprot ID:  Q95JC9
  • Protein name:  Parotid hormone
  • Gene name:  NA
  • Organism:  Sus scrofa (Pig)
  • Family:  NA
  • Source:  Animal
  • Expression:  Acinar cells and secretory granules of the parotid gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APPGARPPPGPPPPPPGPSPPRPPPGPPPQ
  • Length:  30(647-676)
  • Propeptide:  MLPILLSVALLALSSARSPFFDLEDANSNSAEKFLRPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLG
  • Signal peptide:  MLPILLSVALLALSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The parotid hormone stimulates dentinal fluid transport in teeth.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95JC9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004569_AF2.pdbhor004569_ESM.pdb

Physical Information

Mass: 337568 Formula: C134H201N37O33
Absent amino acids: CDEFHIKLMNTVWY Common amino acids: P
pI: 12.5 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -144.33 Boman Index: -3140
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 6.67
Instability Index: 13453 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15805110
  • Title:  Cloning and functional study of porcine parotid hormone, a novel proline-rich protein.
  • PubMed ID:  7371600
  • Title:   Isolation and partial characterization of a porcine parotid hormone that stimulates dentinal fluid transport.